PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KXZ45304.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Chlamydomonadales; Volvocaceae; Gonium
Family GATA
Protein Properties Length: 645aa    MW: 65216.9 Da    PI: 8.0694
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KXZ45304.1genomeGPGRPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA512e-16596627132
        GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                 C++Cgt +Tp WR gp g+ktLCnaCG++y k
  KXZ45304.1 596 CTQCGTQTTPVWRAGPHGPKTLCNACGVRYMK 627
                 *****************************966 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.28E-12589632No hitNo description
SMARTSM004013.7E-14590641IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.189590625IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.105.2E-13594627IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.7E-14596627IPR000679Zinc finger, GATA-type
CDDcd002025.46E-11596625No hitNo description
PROSITE patternPS003440596621IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 645 aa     Download sequence    Send to blast
MSLDDIAAAD TYGQAMCGWS STADSAAAVA GSGCQQATAA SWNAIPALPD RGSDSSGAPA  60
AAKPFAAAPA LPAATRVAVA VPDHLSNGHD SSDCDLSHTV GDGESSGVGY GKRSSHSEAS  120
EDNTAGAPAS AAGCDEEHIS PKAPACGGLS LMRLNYGAPG EQQRQPQQGL MSRAYSVDNF  180
ALSGEGGYAQ GCQPSSGCTD TSMQQQRRPQ VFRTYSYIGP DTLPMEFSLG ADDSGRPVAF  240
GSRGRSASMN DVQLRRQWLH GGELLAPQLP PSVDELELLE LPEDTLPFRP TRGSAFLAGS  300
QLVSAQPPLR AEPIKEEEED GPAAPGVGAQ GSGVGAGGCP PGPSGLMQFR GDGGAAAGSA  360
SGTHGVVVKR KIITTPSPLL HQPRQRVRQP PASAGGAAAA TAKGQSPKRA KVGAGGAAVC  420
AGSIAPWEEG AADAPSTSSA GVLAGWQPPR HGGGGMKSVR SMPANMNSFM EGVEVTVQPL  480
NVPFDAGVIP VDGAAASGAG PNGSVLAPAA MGVAAAQQGC GAVAVPPAVP AARPKGSKRA  540
QQPPHPPPPP FIAPGMAFPE PRRHNLVPSV PKPRKRASPN GNPPKAPAPN PNGHCCTQCG  600
TQTTPVWRAG PHGPKTLCNA CGVRYMKVAK GNVAPTPRKQ QQHNH
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A150G6560.0A0A150G656_GONPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP43691012
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.15e-07GATA transcription factor 9